lever.co

🖥 Status: up
🕒 Response Time: 0.317 sec
⬅️ Response Code: 200
lever.co

36 availability checks of lever.co had over the 1 996 day period starting from February 24, 2021. Lever.co was available 36 times from the aggregate checks conducted, with the latest recorded uptime on July 7, 2026, returning a code 200. No downtime occurrences were observed for lever.co during inspections conducted as of August 14, 2026. No response had an error status, according to the replies that were received as of August 14, 2026. Lever.co showed a response time of 0.317 seconds on July 7, 2026, contrasting the average of 1.023 seconds.

3.0
36
Last Updated: July 7, 2026

Lever overview

Domain
lever.co
Title
Lever | Flexible Recruiting Software for Today's Hiring Teams
Description
Find, nurture, and hire the best talent easily and efficiently with Lever’s powerful recruiting software. Elevate your hiring results and book a demo today.
Main Topic
Recruitment Software for Dynamic Hiring Teams
E Site Status Rank
5 031
Search Wikipedia
lever.co
Alternatives
alternatives to lever.co
Recently checked
watchmygirlfriend.tv

svet24.si

Last Updated: July 7, 2026
Status: up
Response Time: 0.124 sec
Response Code: 200

betootaadvocate.com

Last Updated: June 30, 2026
Status: up
Response Time: 0.107 sec
Response Code: 200

rolls-roycemotorcars.com

Last Updated: June 26, 2026
Status: up
Response Time: 0.001 sec
Response Code: not set

piter.tv

Last Updated: April 12, 2026
Status: up
Response Time: 0.245 sec
Response Code: 200

eventials.com

Last Updated: May 31, 2026
Status: up
Response Time: 0.768 sec
Response Code: 200

cetelem.ru

Last Updated: June 7, 2026
Status: down
Response Time: — sec
Response Code:

bitconnectpool.co

Last Updated: July 5, 2026
Status: down
Response Time: — sec
Response Code:

Lever.co
status check request map as of August 14, 2026

lever.co request, July 7, 2026

Country report for lever.co as of August 14, 2026

United States 100.00%
19:29
SiteTotal ChecksLast Modified
thumbtack.comthumbtack.com33January 28, 2021
watchmygirlfriend.tvwatchmygirlfriend.tv68November 19, 2020
lever.colever.co36February 24, 2021
game-game.com.uagame-game.com.ua59January 18, 2021
dstv.comdstv.com41January 28, 2021

Piter.tv

Lever.co

General SEO Report

Page TitlePage Title tips for lever.co: An effective website title is concise, keyword-rich, and accurately descriptive of the page it represents; place your main target keyword near the beginning to clearly define content relevance to search engines, encouraging higher rankings and providing an immediate understanding for users scrolling through search results.
Lever | Flexible Recruiting Software for Today's Hiring Teams

Length: 66 characters
Meta DescriptionMeta Description tips for lever.co: An effective meta description should act as a concise preview and call to action, clearly communicating the page's topic and unique selling proposition in a compelling and readable manner that encourages searchers to click through to your site.
Find, nurture, and hire the best talent easily and efficiently with Lever’s powerful recruiting software. Elevate your hiring results and book a demo today.

Length: 162 characters
Meta KeywordsMeta Keywords tips for lever.co: For website owners seeking genuine online visibility, the focus should be on ethical SEO practices centered around user experience, content quality, and technical optimization, which build sustainable rankings far more effectively than keyword tag manipulation ever did.
no meta keywords data for lever.co
2026-08-14T03:05:02+00:00
Page ContentPage Content tips for lever.co: Improve page content performance by conducting in-depth keyword research and thought leadership topic analysis, strategically placing primary and secondary keywords in titles, meta descriptions, headings, and the main body text to align with both user intent and search engine algorithms for optimal ranking potential.
Web Page Content Length: 94098 characters
H1 HeadingH1 Heading tips for lever.co: A single, focused H1 statement avoids diluting your message, preventing keyword cannibalization, and ensuring all page content logically supports the primary H1 headline effectively.
Recruitment Software for Dynamic Hiring Teams

Count: 1 heading tag
H2 HeadingsH2 Headings tips for lever.co: For optimal SEO, ensure each H2 tag is concise, accurately summarizes the upcoming section's content, and targets secondary keywords related to the main topic.
Whatever Comes Next, Lever Moves With You
Why Lever?
Recognized by the Best in the Biz
Praised by the People Who Matter Most
Discover the Employ Advantage with Our AI Companions by Your Side
Real Options. Real Flexibility. For All the Ways You Hire.
Ready to Power Your Hiring Momentum?
Lever Talent Acquisition Software FAQs: Your Questions Answered
What is Lever and how does it support modern recruiting?
How does Lever’s applicant tracking system work?
Does Lever include AI Companion or recruitment automation tools or automation tools?
What integrations does Lever support?
How does Lever compare to other applicant tracking systems like Greenhouse, Workable, or Ashby?


Count: 13 heading tag
H3 HeadingsH3 Headings tips for lever.co: Create H3 headers that not only inform but also engage the reader, summarizing the upcoming section's key takeaways and addressing potential questions or pain points relevant to the main H2 topic.
Tour Our Award-Winning Recruitment Software
See it in Action!
Integrated AI-Powered Interview Tool
Recruiting Realities: What’s Shaping TA Today
ROI That Shakes The Walls
The True AI Revolution in Talent Acquisition


Count: 6 heading tag
H4 HeadingsH4 Headings tips for lever.co: Avoid overstuffing H4 tags with keywords, as this can negatively impact user experience through poor readability and may trigger basic spam filters on some platforms.
no h4 headings data for lever.co
2026-08-14T03:05:02+00:00
H5-H6 HeadingsH5-H6 Headings tips for lever.co: When integrating third-party code snippets or detailed technical specifications into a webpage, using appropriately nested H5 and H6 headers can improve content organization and clarity within that specific section
no h5-h6 headings data for lever.co
2026-08-14T03:05:02+00:00
Image ALT AttributesImage ALT Attributes tips for lever.co: When describing product images or complex visuals in e-commerce, use detailed ALT text that highlights key features or benefits, aiding both visually impaired shoppers and search engines in understanding the product's value proposition.
https://www.lever.co/wp-content/uploads/2022/09/Lever_Employ_Logo_Horizontal_Turquoise_Black.png
https://www.lever.co/wp-content/uploads/2023/02/Interview.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Marketing.png
https://www.lever.co/wp-content/uploads/2023/02/High-Volume-Hiring.png
https://www.lever.co/wp-content/uploads/2023/02/Diversity-and-Inclusion.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Automation.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Analytics.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Communication.png
https://www.lever.co/wp-content/uploads/2023/02/Career-Site-Builder.png
https://www.lever.co/wp-content/uploads/2023/02/Recruitment-Add-Ons.png
and 16 more...


Count: 11 images with ALT attributes
Robots.txtRobots.txt tips for lever.co: Incorrectly blocking the robots.txt file itself can prevent you from seeing crawl errors or sitemap references directly in Google Search Console, hindering your ability to diagnose and fix potential SEO issues related to crawl access.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for lever.co: XML sitemaps are fundamental for guiding web crawlers, especially for large, dynamic, or newly launched websites, ensuring thorough content indexing across all relevant pages.
no xml sitemap data for lever.co
2026-08-14T03:05:02+00:00
Page SizePage Size tips for lever.co: Monitor your website's Core Web Vitals through Google Search Console; page size is a direct factor influencing Largest Contentful Paint scores, which are vital for good mobile SEO ranking signals.
page size: 92 kb
Response TimeResponse Time tips for lever.co: Measuring and improving website response times isn't just about user patience; search engines favor sites offering quick loading experiences, making server response optimization a critical factor in both user retention and SEO success metrics.
response time: 1.023 sec
Minify CSSMinify CSS tips for lever.co: Failure to minify your CSS files risks larger download times and potentially higher bounce rates due to slower load speeds, which can negatively impact your website's visibility and ranking on search engine results pages.
Minified:
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/genesis-blocks/dist/style-blocks.build.css?ver=1761151307
https://www.lever.co/wp-includes/blocks/navigation/style.min.css?ver=6.8.3
https://www.lever.co/wp-includes/blocks/image/style.min.css?ver=6.8.3
https://www.lever.co/wp-includes/blocks/cover/style.min.css?ver=6.8.3
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/metronet-profile-picture/dist/blocks.style.build.css?ver=1761151307
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/accordion-blocks/build/index.css?ver=1761151308
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/plugins/fse-pro/assets/css/style.css?ver=1761151308
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-includes/css/dashicons.min.css?ver=1761151310
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/uploads/fonts/d1c78dae9dce76adcc981689089c3929/font.css?ver=1761151309
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/catch-fse/style.css?ver=1761151309
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/theme.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/kuya.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/custom-style.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/background-css/1/www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/lever-catch-fse/assets/css/custom-lev-3mw.css?ver=1761151310&wpr_t=1763826073
https://www.lever.co/wp-content/uploads/wp-rocket/cache/min/1/wp-content/themes/catch-fse/style.css?ver=1761151309


included in the page
Minify JavaScriptMinify JavaScript tips for lever.co: For Progressive Web App (PWA) implementation, minifying JavaScript files is fundamental for achieving quick load times and providing a seamless offline or low-connectivity user experience.
Minified:
https://www.lever.co/wp-content/plugins/nelio-ab-testing/assets/dist/js/visitor-type.js?ver=fed1bd0d2f7778dac059
https://www.lever.co/wp-includes/js/jquery/jquery.min.js?ver=3.7.1
https://www.lever.co/wp-includes/js/jquery/jquery-migrate.min.js?ver=3.4.1
https://plausible.io/js/script.tagged-events.js
//659-JST-226.mktoweb.com/js/forms2/js/forms2.min.js
https://www.lever.co/wp-content/plugins/accordion-blocks/js/accordion-blocks.min.js?ver=1.5.0
https://www.lever.co/wp-content/plugins/wp-rocket/assets/js/lazyload/17.8.3/lazyload.min.js


detected during site scan
Structured DataStructured Data tips for lever.co: Schema.org structured data implementation is crucial for modern SEO, as it allows you to control how search engines represent your content in SERPs, often resulting in more informative, clickable search result listings known as rich snippets.
no structured data data for lever.co
2026-08-14T03:05:02+00:00
CDN UsageCDN Usage tips for lever.co: Integrating a Content Delivery Network (CDN) into your web infrastructure significantly reduces the load on your origin server, improving its stability and responsiveness, especially during sudden traffic spikes, thus ensuring better website uptime.
content is delivered via CDN
SSL certificatesSSL certificates tips for lever.co: Your website's loading speed over HTTPS, influenced by SSL implementation and optimizations like HTTP/2, impacts user experience and SEO. Faster loading times on secure connections reduce page load errors, improve Core Web Vitals metrics, and contribute to better rankings by keeping visitors engaged rather than frustrated and leaving.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:419 016
Minimum Daily Visits:489 693
Minimum Daily Page Views:843 079
Minimum Monthly Unique Visitors:12 570 480
Minimum Monthly Visits:14 690 790
Minimum Monthly Page Views:25 292 370
Minimum Yearly Unique Visitors:150 845 760
Minimum Yearly Visits:176 289 480
Minimum Yearly Page Views:303 508 440
Maximum Daily Unique Visitors:530 080
Maximum Daily Visits:565 419
Maximum Daily Page Views:954 144
Maximum Monthly Unique Visitors:15 902 400
Maximum Monthly Visits:16 962 570
Maximum Monthly Page Views:28 624 320
Maximum Yearly Unique Visitors:190 828 800
Maximum Yearly Visits:203 550 840
Maximum Yearly Page Views:343 491 840

Estimated Valuation

Daily Revenue:US$ 606 - 1 363
Monthly Revenue:US$ 18 180 - 40 890
Yearly Revenue:US$ 218 160 - 490 680

Estimated Worth

Minimum:US$ 327 240
Maximum:US$ 1 472 040

Similarly Ranked Sites

RankPoints
r2games.comr2games.com5 40413 042 646
fuskator.comfuskator.com5 40513 042 645
questionablecontent.netquestionablecontent.net5 40613 042 644
thumbtack.comthumbtack.com5 40713 042 643
watchmygirlfriend.tvwatchmygirlfriend.tv5 40813 042 642
lever.colever.co5 40913 042 641
game-game.com.uagame-game.com.ua5 41013 042 640
dstv.comdstv.com5 41113 042 639
redlink.com.arredlink.com.ar5 41213 042 638
boyfriendtv.comboyfriendtv.com5 41313 042 637
hatenadiary.jphatenadiary.jp5 41413 042 636